PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v0133580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 352aa    MW: 39751.9 Da    PI: 6.3701
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v0133580.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-092773131955
                      HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +k +yps++++  LA+ +gL+++q+ +WF N+R ++
  Lj4g3v0133580.1 277 HYKWPYPSESQKLALAEATGLDQKQINNWFINQRKRH 313
                      45679*****************************885 PP

2ELK40.46e-14233254122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK qLl+KYsgyLg+LkqEF+
  Lj4g3v0133580.1 233 ELKVQLLHKYSGYLGNLKQEFM 254
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.5E-1997141IPR005540KNOX1
PfamPF037905.8E-2298137IPR005540KNOX1
SMARTSM012567.9E-26148199IPR005541KNOX2
PfamPF037912.6E-22151197IPR005541KNOX2
SMARTSM011888.7E-7233254IPR005539ELK domain
PfamPF037891.0E-8233254IPR005539ELK domain
PROSITE profilePS5121310.842233253IPR005539ELK domain
PROSITE profilePS5007113.021253316IPR001356Homeobox domain
SuperFamilySSF466894.71E-19255329IPR009057Homeodomain-like
SMARTSM003892.3E-12255320IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.7E-28258317IPR009057Homeodomain-like
CDDcd000864.66E-12265317No hitNo description
PfamPF059207.0E-17273312IPR008422Homeobox KN domain
PROSITE patternPS000270291314IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MEGSSSVMMG FGENNNNSGI YPMTMMPAFM NSSTLNNPNQ DTTNSFFFPM PCTSNHDPNP  60
NNLNTNTNNN TGLGQYFMED QINHNINKDG SSSTSAAAVK AKIMAHPHYQ RLLAAYVNCQ  120
KIGAPPEVVA RLEEACASAA AMAGVSGGTA CIGEDPSLDQ FMEAYCEMLI KYQQELSKPF  180
KEAMLFLQRI ECQLNSLAIS SDFACAEATD RIGSSENVDL HNNMIDPQVE DQELKVQLLH  240
KYSGYLGNLK QEFMKKRKKG KLPKEARQQL LEWWSRHYKW PYPSESQKLA LAEATGLDQK  300
QINNWFINQR KRHWKPSDDM QFMVMEPSHP HQYMNSTVLG NHFPMDLSHT ML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1248257LKQEFMKKRK
2254258KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237352.11e-160KNT1
RefseqXP_007153990.11e-160hypothetical protein PHAVU_003G081800g
SwissprotP466081e-150HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A151SU491e-161A0A151SU49_CAJCA; Homeobox protein SBH1
STRINGGLYMA07G39350.11e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-119KNOX/ELK homeobox transcription factor